PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008229117.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 255aa    MW: 29171.7 Da    PI: 5.5171
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008229117.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.97.3e-4841351128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                     lppG+rF Pt+eelv++yL +k+egk+ ++ +vi+ vdiy+ ePwdLpk     +++++++w+fF++r++++a+g r+nr+t+sgyWkatg+   
  XP_008229117.1   4 LPPGYRFYPTEEELVSFYLLNKLEGKRDDTRRVIPVVDIYRKEPWDLPKfsgeLCHGDTEQWFFFTPRQQREAQGGRPNRTTASGYWKATGSPGY 98 
                     79****************************99****************656754445777*********************************** PP

             NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     v+s++++++g+kkt+vfykg+ap+g+kt+W m+eyr+
  XP_008229117.1  99 VYSSDNKVIGMKKTMVFYKGKAPTGRKTKWKMNEYRA 135
                     ***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-513165IPR003441NAC domain
PROSITE profilePS5100550.3484166IPR003441NAC domain
PfamPF023654.4E-255134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MEELPPGYRF YPTEEELVSF YLLNKLEGKR DDTRRVIPVV DIYRKEPWDL PKFSGELCHG  60
DTEQWFFFTP RQQREAQGGR PNRTTASGYW KATGSPGYVY SSDNKVIGMK KTMVFYKGKA  120
PTGRKTKWKM NEYRAIEADN PTTTTTTNSV PKYLRNEFRL CRVYVVSGSC RAFDRRPLEG  180
GGETKHQLSE SMGGTSTFSL MAPMVEKASS SDETYSYSGE LADLPETSAG INSTDWEIIE  240
GLEQPLWEWE QLNLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-37417117170NAC domain-containing protein 19
4dul_A2e-37417117170NAC domain-containing protein 19
1ut7_B2e-37417117170NO APICAL MERISTEM PROTEIN
1ut7_A2e-37417117170NO APICAL MERISTEM PROTEIN
1ut4_B2e-37417117170NO APICAL MERISTEM PROTEIN
1ut4_A2e-37417117170NO APICAL MERISTEM PROTEIN
3swp_D2e-37417120173NAC domain-containing protein 19
3swp_C2e-37417120173NAC domain-containing protein 19
3swp_B2e-37417120173NAC domain-containing protein 19
3swp_A2e-37417120173NAC domain-containing protein 19
3swm_D2e-37417120173NAC domain-containing protein 19
3swm_C2e-37417120173NAC domain-containing protein 19
3swm_B2e-37417120173NAC domain-containing protein 19
3swm_A2e-37417120173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0517666e-41BT051766.1 Medicago truncatula clone MTYF5_F6_F7_F81G-H-6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008229117.10.0PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR32e-91NAC90_ARATH; NAC domain-containing protein 90
TrEMBLM5WHE70.0M5WHE7_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s22630.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-91NAC domain containing protein 90